NSJ Bioreagents

Emerin Antibody

Product Code:
 
NSJ-RQ4516
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG1
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
5A10
Regulatory Status:
 
RUO
Target Species:
 
Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the Emerin antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
Western blot testing of human 1) HeLa, 2) placenta, 3) Caco-2, 4) HepG2, 5) Rabbit IgG, 6) marker, 7) Jurkat, 8) MDA-MB-453, 9) SK-OV-3 and 10) U-87 MG lysate with Emerin antibody at 0.5ug/ml. Expected molecular weight: 29-34 kDa.
2 / 3
IHC testing of FFPE human gastric cancer with Emerin antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
3 / 3
IHC testing of FFPE human rectal cancer with Emerin antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Western blot testing of human 1) HeLa, 2) placenta, 3) Caco-2, 4) HepG2, 5) Rabbit IgG, 6) marker, 7) Jurkat, 8) MDA-MB-453, 9) SK-OV-3 and 10) U-87 MG lysate with Emerin antibody at 0.5ug/ml. Expected molecular weight: 29-34 kDa.
IHC testing of FFPE human gastric cancer with Emerin antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC testing of FFPE human rectal cancer with Emerin antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4516-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the Emerin antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Stabilizes and promotes the formation of a nuclear actin cortical network. Stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments. Inhibits beta-catenin activity by preventing its accumulation in the nucleus. Acts by influencing the nuclear accumulation of beta- catenin through a CRM1-dependent export pathway. Links centrosomes to the nuclear envelope via a microtubule association. EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD. Required for proper localization of non-farnesylated prelamin-A/C. [UniProt]
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL were used as the immunogen for the Emerin antibody.
Limitation:
This Emerin antibody is available for research use only.
Localization:
Nuclear membrane
Purity:
Protein G affinity
Species Reactivity :
Human
Uniprot #:
P50402