NSJ Bioreagents

ATP11C Antibody

Product Code:
 
NSJ-RQ6040
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Western Blot (WB)
Storage:
 
After reconstitution, the ATP11C antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
1 / 3
Immunofluorescent staining of FFPE human U-2 OS cells with ATP11C antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 3
Western blot testing of human 1) HEK293, 2) K562, 3) PC-3 and 4) HeLa lysate with ATP11C antibody. Predicted molecular weight ~129 kDa.
3 / 3
Flow cytometry testing of human A549 cells with ATP11C antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ATP11C antibody.
❮❯

Immunofluorescent staining of FFPE human U-2 OS cells with ATP11C antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HEK293, 2) K562, 3) PC-3 and 4) HeLa lysate with ATP11C antibody. Predicted molecular weight ~129 kDa.
Flow cytometry testing of human A549 cells with ATP11C antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ATP11C antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ6040-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the ATP11C antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
ATP11C is an enzyme that in humans is encoded by the ATP11C gene. This gene is mapped to Xq27.1.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QNHEIELTKVHVERNAMDGYRTLCVAFKEIAPDDYER from the human protein were used as the immunogen for the ATP11C antibody.
Limitation:
This ATP11C antibody is available for research use only.
Localization:
Cytoplasmic, plasma membrane
Purity:
Affinity purified
Species Reactivity :
Human
Uniprot #:
Q8NB49