NSJ Bioreagents

ALKBH1 Antibody

Product Code:
 
NSJ-RQ5956
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the ALKBH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
1 / 6
IHC staining of FFPE human intestinal cancer with ALKBH1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 6
IHC staining of FFPE human testis cancer with ALKBH1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 6
IHC staining of FFPE human breast cancer with ALKBH1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 6
Immunofluorescent staining of FFPE human U-2 OS cells with ALKBH1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
5 / 6
Western blot testing of human 1) Jurkat and 2) K562 lysate with ALKBH1 antibody. Predicted molecular weight ~44 kDa.
6 / 6
Flow cytometry testing of human A431 cells with ALKBH1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ALKBH1 antibody.
❮❯

IHC staining of FFPE human intestinal cancer with ALKBH1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human testis cancer with ALKBH1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer with ALKBH1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human U-2 OS cells with ALKBH1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) Jurkat and 2) K562 lysate with ALKBH1 antibody. Predicted molecular weight ~44 kDa.
Flow cytometry testing of human A431 cells with ALKBH1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ALKBH1 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ5956-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry: 1-2ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the ALKBH1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Nucleic acid dioxygenase ALKBH1 is an enzyme that in humans is encoded by the ALKBH1 gene. It is mapped to 14q24.3. This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids YLKTARVNMTVRQVLATDQNFPLEPIEDEKRD from the human protein were used as the immunogen for the ALKBH1 antibody.
Limitation:
This ALKBH1 antibody is available for research use only.
Localization:
Nuclear, cytoplasmic
Purity:
Affinity purified
Species Reactivity :
Human
Uniprot #:
Q13686