NSJ Bioreagents

PRDM14 Antibody

Product Code:
 
NSJ-RQ6394
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the PRDM14 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
1 / 10
IHC staining of FFPE human breast cancer with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 10
IHC staining of FFPE human renal clear cell carcinoma tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 10
IHC staining of FFPE human ovarian serous adenocarcinoma tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 10
IHC staining of FFPE human rectal cancer tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 10
IHC staining of FFPE human ovarian cancer tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 10
IHC staining of FFPE mouse testis tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
7 / 10
IHC staining of FFPE rat testis tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
8 / 10
Immunofluorescent staining of FFPE human HeLa cells with PRDM14 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
9 / 10
Western blot testing of 1) rat testis, 2) rat spleen, 3) rat C6, 4) rat PC-12, 5) mouse testis, 6) mouse spleen, 7) mouse NIH 3T3 and 8) mouse Neuro-2a cell lysate with PRDM14 antibody. Predicted molecular weight: ~64 kDa.
10 / 10
Flow cytometry testing of human SiHa cells with PRDM14 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PRDM14 antibody.
❮❯

IHC staining of FFPE human breast cancer with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human renal clear cell carcinoma tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human ovarian serous adenocarcinoma tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human rectal cancer tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human ovarian cancer tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse testis tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat testis tissue with PRDM14 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human HeLa cells with PRDM14 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) rat testis, 2) rat spleen, 3) rat C6, 4) rat PC-12, 5) mouse testis, 6) mouse spleen, 7) mouse NIH 3T3 and 8) mouse Neuro-2a cell lysate with PRDM14 antibody. Predicted molecular weight: ~64 kDa.
Flow cytometry testing of human SiHa cells with PRDM14 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PRDM14 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ6394-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence (FFPE): 5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the PRDM14 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
This gene encodes a member of the PRDI-BF1 and RIZ homology domain containing (PRDM) family of transcriptional regulators. The encoded protein may possess histone methyltransferase activity and plays a critical role in cell pluripotency by suppressing the expression of differentiation marker genes. Expression of this gene may play a role in breast cancer.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEA were used as the immunogen for the PRDM14 antibody.
Limitation:
This PRDM14 antibody is available for research use only.
Localization:
Nuclear
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9GZV8