Doublecortin Rabbit mAb

WB,1:500 - 1:1000

This gene encodes a member of the doublecortin family. The protein encoded by this gene is a cytoplasmic Protein A Affinity purificationnd contains two doublecortin domains, which bind microtubules. In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The encoded Protein A Affinity purificationppears to direct neuronal migration by regulating the organization and stability of microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex. Mutations in this gene cause abnormal migration of neurons during development and disrupt the layering of the cortex, leading to epilepsy, cognitive disability, subcortical band heterotopia ("double cortex" syndrome) in females and lissencephaly ("smooth brain" syndrome) in males. Multiple transcript variants encoding different isoforms have been found for this gene.

Unconjugated

PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol

DCX

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Doublecortin (O43602).

41kDa

MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQG