REST/NRSF Rabbit mAb

WB,1:500 - 1:1000 | IP,1:500 - 1:1000

This gene was initially identified as a transcriptional repressor that represses neuronal genes in non-neuronal tissues. However, depending on the cellular context, this gene can act as either an oncogene or a tumor suppressor. The encoded protein is a member of the Kruppel-type zinc finger transcription factor family. It represses transcription by binding a DNA sequence element called the neuron-restrictive silencer element. The protein is also found in undifferentiated neuronal progenitor cells and it is thought that this repressor may act as a master negative regulator of neurogenesis. Alternatively spliced transcript variants have been described.

Unconjugated

PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human REST/NRSF (Q13127).

122kDa

KGEPHGLENMELRSLELSVVEPQPVFEASGAPDIYSSNKDLPPETPGAEDKGKSSKTKPFRCKPCQYEAESEEQFVHHIRVHSAKKFFVEESAEKQAKARE