Hsc70/HSPA8 Rabbit pAb

WB,1:500 - 1:1000 | IHC-P,1:50 - 1:200 | IF/ICC,1:50 - 1:200

This gene encodes a member of the heat shock protein 70 family, which contains both heat-inducible and constitutively expressed members. This protein belongs to the latter group, which are also referred to as heat-shock cognate proteins. It functions as a chaperone, and binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Unconjugated

PBS with 0.01% thimerosal, 50% glycerol

Recombinant fusion protein containing a sequence corresponding to amino acids 510-615 of human Hsc70/HSPA8 (NP_006588.1).

71kDa

LSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAG