ApolipoProtein A Affinity purification1 Rabbit mAb

WB,1:500 - 1:1000 | IF/ICC,1:50 - 1:200

This gene encodes apolipoProtein A Affinity purification-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein.

Unconjugated

PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ApolipoProtein A Affinity purification1 (P02647).

28kDa

MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLE