NSJ Bioreagents

Hsp90 beta Antibody / HSP90AB1

Product Code:
 
NSJ-RQ7569
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG2b
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
7B7F5
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Western Blot (WB)
Storage:
 
After reconstitution, the Hsp90 beta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
1 / 3
Immunofluorescent staining of FFPE human MCF-7 cells with Hsp90 beta antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 3
Western blot testing of 1) human HeLa, 2) human Jurkat, 3) human Raji, 4) human A431, 5) rat brain, 6) rat heart, 7) mouse brain and 8) mouse heart tissue lysate with Hsp90 beta antibody. Predicted molecular weight: 84-90 kDa.
3 / 3
Flow cytometry testing of human Caco-2 cells with Hsp90 beta antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Hsp90 beta antibody.
❮❯

Immunofluorescent staining of FFPE human MCF-7 cells with Hsp90 beta antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human HeLa, 2) human Jurkat, 3) human Raji, 4) human A431, 5) rat brain, 6) rat heart, 7) mouse brain and 8) mouse heart tissue lysate with Hsp90 beta antibody. Predicted molecular weight: 84-90 kDa.
Flow cytometry testing of human Caco-2 cells with Hsp90 beta antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Hsp90 beta antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ7569-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Show All

Further Information

Application Details:
Western blot: 0.5-1ug/ml,Immunofluorescence: 5ug/ml,Flow cytometry: 1-3ug/million cells
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 449-481 (RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK) from the human protein were used as the immunogen for the Hsp90 beta antibody.
Localisation:
Cytoplasmic, nuclear
Purity:
Antigen affinity purified
Uniprot #:
P08238