NSJ Bioreagents

Myosin Phosphatase Antibody / PPP1R12A

Product Code:
 
NSJ-R31804
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the PPP1R12A antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 7
Western blot testing of 1) mouse skeletal muscle and 2) human HeLa lysate with PPP1R12A antibody. Expected molecular weight: 110~130 kDa, observed here at ~150 kDa.
2 / 7
IHC testing of FFPE human glioma tissue with PPP1R12A antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 7
Flow cytometry testing of human SiHa cells with PPP1R12A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPP1R12A antibody.
4 / 7
Flow cytometry testing of human U-251 MG cells with PPP1R12A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPP1R12A antibody.
5 / 7
Flow cytometry testing of human HeLa cells with PPP1R12A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPP1R12A antibody.
6 / 7
IHC testing of FFPE human U-251 MG cells with PPP1R12A antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
7 / 7
IHC testing of FFPE human SiHa cells with PPP1R12A antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
❮❯

Western blot testing of 1) mouse skeletal muscle and 2) human HeLa lysate with PPP1R12A antibody. Expected molecular weight: 110~130 kDa, observed here at ~150 kDa.
IHC testing of FFPE human glioma tissue with PPP1R12A antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Flow cytometry testing of human SiHa cells with PPP1R12A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPP1R12A antibody.
Flow cytometry testing of human U-251 MG cells with PPP1R12A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPP1R12A antibody.
Flow cytometry testing of human HeLa cells with PPP1R12A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPP1R12A antibody.
IHC testing of FFPE human U-251 MG cells with PPP1R12A antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE human SiHa cells with PPP1R12A antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31804-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells,Immunofluorescence (FFPE): 2-4ug/ml
Application Note:
Optimal dilution of the PPP1R12A antibody should be determined by the researcher.
Description:
PPP1R12A (Protein phosphatase 1 regulatory subunit 12A), also called MYPT1 (Myosin phosphatase target subunit 1), is an enzyme that in humans is encoded by the PPP1R12A gene. PPP1R12A is one of the subunits of myosin phosphatase. Sequencing analysis showed that human PPP1R12A contains 1,030 amino acids with a calculated molecular mass of approximately 115 kD. The PPP1R12A gene is mapped on 12q21.2-q21.3. PPP1R12A is the protein that regulates PP1 function in smooth muscle relaxation. The cellular MYPT1-PP1-delta -specific inhibitor CPI17 caused a loss of merlin function characterized by merlin phosphorylation, Ras activation, and transformation. Jin et al. concluded that PPP1R12A and its substrate merlin are part of a previously undescribed tumor suppressor cascade that can be hindered in two ways, by mutation of the NF2 gene and by upregulation of the oncoprotein CPI17.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD of human PPP1R12A were used as the immunogen for the PPP1R12A antibody.
Limitation:
This PPP1R12A antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse
Uniprot #:
O14974