NSJ Bioreagents

NARG1 Antibody / NAA15

Product Code:
 
NSJ-R32787
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the NARG1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Western blot testing of human 293T cell lysate with NARG1 antibody at 0.5ug/ml. Predicted molecular weight ~101 kDa.~
2 / 2
IHC testing of FFPE mouse intestine tissue with NARG1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for
❮❯

Western blot testing of human 293T cell lysate with NARG1 antibody at 0.5ug/ml. Predicted molecular weight ~101 kDa.~
IHC testing of FFPE mouse intestine tissue with NARG1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32787-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the NARG1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
NMDA receptor-regulated protein 1 (NARG1), also known as GA19 or Tbdn100 is a protein that in humans is encoded by the NAA15 gene. It is mapped to chromosome 4. NARG1 is the auxiliary subunit of the NatA (N-alpha-acetyltransferase A) complex. Both, Naa15 and Naa16 interact with the ribosome in yeast (via the ribosomal proteins, uL23 and uL29), humans and rat, thereby linking the NatA/Naa10 to the ribosome and facilitating co-translational acetylation of nascent polypeptide chains as they emerges from the exit tunnel. Furthermore, Naa15 might act as a scaffold for other factors, including the chaperone like protein HYPK (Huntingtin Interacting Protein K) and Naa50, the catalytic acetyltransferase subunit of NatE.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 244-287 (ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY) from the human protein were used as the immunogen for the NARG1 antibody.
Limitation:
This NARG1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse
Uniprot #:
Q9BXJ9