NSJ Bioreagents

NME1 Antibody / NM23

Product Code:
 
NSJ-R31976
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
 
After reconstitution, the NM23 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 4
Western blot testing of 1) rat brain, 2) rat liver, 3) human HeLa and 4) mouse NIH3T3 lysate with NM23 antibody. Expected molecular weight: 17/20 kDa (NM23-H1A/-H1B).
2 / 4
Flow cytometry testing of human A549 cells with NM23 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NM23 antibody.
3 / 4
Flow cytometry testing of human HeLa cells with NM23 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NM23 antibody.
4 / 4
Flow cytometry testing of human U-251 MG cells with NM23 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NM23 antibody.
❮❯

Western blot testing of 1) rat brain, 2) rat liver, 3) human HeLa and 4) mouse NIH3T3 lysate with NM23 antibody. Expected molecular weight: 17/20 kDa (NM23-H1A/-H1B).
Flow cytometry testing of human A549 cells with NM23 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NM23 antibody.
Flow cytometry testing of human HeLa cells with NM23 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NM23 antibody.
Flow cytometry testing of human U-251 MG cells with NM23 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NM23 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31976-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the NM23 antibody should be determined by the researcher.
Description:
NME1, also called NM23, NM23-H1, NDPKA, GAAD or AWD, is an enzyme that in humans is encoded by the NME1 gene. The promoters of the mouse and human NME1 genes, like those of other NME genes, contain several binding sites for AP2, NF1, Sp1, LEF1, and response elements to glucocorticoid receptors. The NME1 gene is mapped on 17q21.33. Immunofluorescence microscopy demonstrated colocalization of NME1 in nuclei of B cells expressing EBNA3C. Expression of EBNA3C reversed the ability of NME1 to inhibit migration of BL and breast carcinoma cells. NM23H1 bound SET and was released from inhibition by GZMA cleavage of SET. After GZMA loading or cytotoxic T lymphocyte attack, SET and NM23H1 translocated to the nucleus and SET was degraded, allowing NM23H1 to nick chromosomal DNA. Using a Drosophila model system, Dammai et al. (2003) showed that the Drosophila NME1 homolog, awd, regulates trachea cell motility by modulating FGFR levels through a dynamin -mediated pathway.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR of human NM23A were used as the immunogen for the NM23 antibody.
Limitation:
This NM23 antibody is available for research use only.
PM_Meta_Key:
Product_Images
PM_Meta_Value:
https://www.nsjbio.com/get_image.php?catalog_no=R31976&type=image1~Western blot testing of 1) rat brain, 2) rat liver, 3) rat lung, 4) rat C6, 5) mouse brain, 6) mouse liver, 7) mouse lung and 8) mouse NIH 3T3 cell lysate with NM23 antibody. Expected molecular weight: 17/20 kDa (NM23-H1A/-H1B).|https://www.nsjbio.com/get_image.php?catalog_no=R31976&type=image2~Western blot testing of human 1) HeLa, 2) A431, 3) HepG2, 4) K562, 5) MCF7, 6) A375 and 7) MOLT4 cell lysate with NM23 antibody. Expected molecular weight: 17/20 kDa (NM23-H1A/-H1B).|https://www.nsjbio.com/get_image.php?catalog_no=R31976&type=image3~Flow cytometry testing of fixed and permeabilized human HEL cells with NM23 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NM23 antibody.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P15531