NSJ Bioreagents

PIAS4 Antibody / PIASg

Product Code:
 
NSJ-R32550
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the PIAS4 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) rat testis, 2) mouse testis and 3) human HeLa lysate with PIAS4 antibody at 0.5ug/ml. Predicted/observed molecular weight ~57 kDa.
❮❯

Western blot testing of 1) rat testis, 2) mouse testis and 3) human HeLa lysate with PIAS4 antibody at 0.5ug/ml. Predicted/observed molecular weight ~57 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32550-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Protein inhibitor of activated STAT protein 4 or protein inhibitor of activated STAT protein gamma (PIASg or PIASy), is an enzyme that in humans is encoded by the PIAS4 gene. This gene is mapped to 19p13.3. This gene plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. It also functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. This gene involved in gene silencing.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 130-174 (EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE) from the human protein were used as the immunogen for the PIAS4 antibody.
Limitation:
This PIAS4 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q8N2W9