NSJ Bioreagents

Platelet Derived Growth Factor Receptor alpha Antibody / PDGFRA

Product Code:
 
NSJ-R31979
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the PDGFR alpha antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
Western blot testing of 1) rat brain, 2) human HeLa, and 3) mouse NIH3T3 lysate with PDGFR alpha antibody. Expected/observed molecular weight: 120~195 kDa, depending on glycosylation level.
2 / 3
IHC testing of FFPE human intestinal cancer wtih PDGFR alpha antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 3
Western blot testing of human 1) HT1080, 2) Caco-2, 3) U-2 OS, 4) PC-3 and 5) 293T cell lysate with PDGFR alpha antibody. Expected/observed molecular weight: 120~195 kDa, depending on glycosylation level.

Western blot testing of 1) rat brain, 2) human HeLa, and 3) mouse NIH3T3 lysate with PDGFR alpha antibody. Expected/observed molecular weight: 120~195 kDa, depending on glycosylation level.
IHC testing of FFPE human intestinal cancer wtih PDGFR alpha antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of human 1) HT1080, 2) Caco-2, 3) U-2 OS, 4) PC-3 and 5) 293T cell lysate with PDGFR alpha antibody. Expected/observed molecular weight: 120~195 kDa, depending on glycosylation level.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31979-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the PDGFR alpha antibody should be determined by the researcher.
Description:
PDGFRA (Platelet-derived growth factor receptor, alpha), also called PDGFR2 and CD140a, encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. The PDGFA gene is mapped on 4q12. The PDGFRA-FIP1L1 gene is a constitutively activated tyrosine kinase that transforms hematopoietic cells and is a therapeutic target of imatinib. And the PDGFRA gene contains 23 exons spanning about 65 kb. Using the human PDGFRA promoter linked to a luciferase reporter, Joosten et al. showed that PAX1 acts as a transcriptional activator of the PDGFRA gene in differentiated human embryonal carcinoma cells. PDGFRA is responsible for mediating cellular contraction of multiple growth factors: TGFB1 and members of the PDGF family. Lei et al. noted that in the rabbit model of the disease, PDGFRA is dramatically more capable of promoting PVR than is the closely related PDGFRB. PDGFRA is a critical receptor required for human CMV infection, and thus a target for novel antiviral therapies.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKD of human PDGFRA were used as the immunogen for the PDGFR alpha antibody.
Limitation:
This PDGFR alpha antibody is available for research use only.
Localization:
Cytoplasmic, membrane
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P16234