NSJ Bioreagents

PSMA3 Antibody / Proteasome 20S alpha 3

Product Code:
 
NSJ-R32557
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the PSMA3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 5
Western blot testing of 1) rat testis, 2) mouse lung and 3) human 293T lysate with PSMA3 antibody at 0.5ug/ml. Predicted/observed molecular weight ~28 kDa.
2 / 5
IHC testing of FFPE human intestine cancer tissue with PSMA3 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
3 / 5
IHC testing of FFPE mouse brain with PSMA3 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
4 / 5
IHC testing of FFPE rat brain with PSMA3 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
5 / 5
Flow cytometry testing of human HeLa cells with PSMA3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PSMA3 antibody.

Western blot testing of 1) rat testis, 2) mouse lung and 3) human 293T lysate with PSMA3 antibody at 0.5ug/ml. Predicted/observed molecular weight ~28 kDa.
IHC testing of FFPE human intestine cancer tissue with PSMA3 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE mouse brain with PSMA3 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE rat brain with PSMA3 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human HeLa cells with PSMA3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PSMA3 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32557-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Proteasome subunit alpha type-3, also known as macropain subunit C8 and proteasome component C8, is a protein that in humans is encoded by the PSMA3 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 88-127 (LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS) from the human protein were used as the immunogen for the PSMA3 antibody.
Limitation:
This PSMA3 antibody is available for research use only.
Localization:
Cytoplasmic, nuclear
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P25788