NSJ Bioreagents

RAB13 Antibody

Product Code:
 
NSJ-R32126
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the RAB13 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
Immunofluorescent staining of FFPE human MCF7 cells with RAB13 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 3
Western blot testing of human 1) HeLa, 2) Caco-2, 3) MCF7 and 4) 293T cell lysate with RAB13 antibody. Expected molecular weight: ~23 kDa.
3 / 3
Flow cytometry testing of human U-87 MG cells with RAB13 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RAB13 antibody.

Immunofluorescent staining of FFPE human MCF7 cells with RAB13 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HeLa, 2) Caco-2, 3) MCF7 and 4) 293T cell lysate with RAB13 antibody. Expected molecular weight: ~23 kDa.
Flow cytometry testing of human U-87 MG cells with RAB13 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RAB13 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32126-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunofluorescence (FFPE): 5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the RAB13 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Ras-related protein Rab-13 is a protein that in humans is encoded by the RAB13 gene. This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids NKCDMEAKRKVQKEQADKLAREHGIRFFET of human RAB13 were used as the immunogen for the RAB13 antibody.
Limitation:
This RAB13 antibody is available for research use only.
Localization:
Cytoplasmic, membrane
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
P51153