NSJ Bioreagents

SCTR Antibody

Product Code:
 
NSJ-R32564
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the SCTR antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) rat kidney and 2) human SKOV3 lysate with SCTR antibody at 0.5ug/ml. Expected molecular weight: 50-64 kDa depending on glycosylation level.
❮❯

Western blot testing of 1) rat kidney and 2) human SKOV3 lysate with SCTR antibody at 0.5ug/ml. Expected molecular weight: 50-64 kDa depending on glycosylation level.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32564-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Human secretin receptor (gene name SCTR) is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. The SCTR gene is mapped to chromosome 2q14.1 by fluorescence in situ hybridization.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 398-440 (EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII) from the human protein were used as the immunogen for the SCTR antibody.
Limitation:
This SCTR antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
P47872