NSJ Bioreagents

SMAD Antibody (SMAD1-5)

Product Code:
 
NSJ-R32238
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the SMAD antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) rat heart, 2) mouse heart, 3) rat skeletal muscle, 4) mouse skeletal muscle, 5) 293, 6) MCF7 and 7) HeLa lysate with SMAD antibody. Expected molecular weight of SMADs 1-5: 48~60 kDa, observed here at ~52 kDa.

Western blot testing of 1) rat heart, 2) mouse heart, 3) rat skeletal muscle, 4) mouse skeletal muscle, 5) 293, 6) MCF7 and 7) HeLa lysate with SMAD antibody. Expected molecular weight of SMADs 1-5: 48~60 kDa, observed here at ~52 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32238-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the SMAD antibody should be determined by the researcher.
Description:
SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-beta superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH of human SMAD1-5 were used as the immunogen for the SMAD antibody.
Limitation:
This SMAD antibody is available for research use only.
Localization:
Nuclear and cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q15797