NSJ Bioreagents

SMAD1 / SMAD5 Antibody

Product Code:
 
NSJ-RQ4044
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the SMAD1/5 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) rat kidney, 2) rat testis, 3) mouse brain, 4) mouse kidney, 5) mouse testis, 6) human HeLa, 7) human A375 and 8) human HepG2 lysate with SMAD1/5 antibody at 0.5ug/ml. Expected molecular weight: 52-60 kDa.

Western blot testing of 1) rat kidney, 2) rat testis, 3) mouse brain, 4) mouse kidney, 5) mouse testis, 6) human HeLa, 7) human A375 and 8) human HepG2 lysate with SMAD1/5 antibody at 0.5ug/ml. Expected molecular weight: 52-60 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4044-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western Blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the SMAD1/5 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-? superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK from the human protein were used as the immunogen for the SMAD1/5 antibody.
Limitation:
This SMAD1/5 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q15797